![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.1: Sialidases [50939] (2 families) ![]() |
![]() | Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins) |
![]() | Protein Micromonospora sialidase, N-terminal domain [50946] (1 species) |
![]() | Species Micromonospora viridifaciens [TaxId:1881] [50947] (8 PDB entries) Uniprot Q02834 47-647 |
![]() | Domain d1wcqa3: 1wcq A:47-404 [120896] Other proteins in same PDB: d1wcqa1, d1wcqa2, d1wcqb1, d1wcqb2, d1wcqc1, d1wcqc2 automatically matched to d1eur__ complexed with dan, gol, na; mutant |
PDB Entry: 1wcq (more details), 2.1 Å
SCOP Domain Sequences for d1wcqa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wcqa3 b.68.1.1 (A:47-404) Micromonospora sialidase, N-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt irmscddgqtwpvskvfqpgsmsfstltalpdgtygllyepgtgiryanfnlawlggi
Timeline for d1wcqa3: