Lineage for d1wcqa3 (1wcq A:47-404)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 807194Superfamily b.68.1: Sialidases [50939] (2 families) (S)
  5. 807195Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)
  6. 807297Protein Micromonospora sialidase, N-terminal domain [50946] (1 species)
  7. 807298Species Micromonospora viridifaciens [TaxId:1881] [50947] (8 PDB entries)
    Uniprot Q02834 47-647
  8. 807304Domain d1wcqa3: 1wcq A:47-404 [120896]
    Other proteins in same PDB: d1wcqa1, d1wcqa2, d1wcqb1, d1wcqb2, d1wcqc1, d1wcqc2
    automatically matched to d1eur__
    complexed with dan, gol, na; mutant

Details for d1wcqa3

PDB Entry: 1wcq (more details), 2.1 Å

PDB Description: mutagenesis of the nucleophilic tyrosine in a bacterial sialidase to phenylalanine.
PDB Compounds: (A:) sialidase

SCOP Domain Sequences for d1wcqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wcqa3 b.68.1.1 (A:47-404) Micromonospora sialidase, N-terminal domain {Micromonospora viridifaciens [TaxId: 1881]}
geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
irmscddgqtwpvskvfqpgsmsfstltalpdgtygllyepgtgiryanfnlawlggi

SCOP Domain Coordinates for d1wcqa3:

Click to download the PDB-style file with coordinates for d1wcqa3.
(The format of our PDB-style files is described here.)

Timeline for d1wcqa3: