Class b: All beta proteins [48724] (174 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) |
Family b.18.1.1: Galactose-binding domain [49786] (2 proteins) |
Protein Sialidase, C-terminal domain [49789] (1 species) |
Species Micromonospora viridifaciens [TaxId:1881] [49790] (6 PDB entries) Uniprot Q02834 47-647 |
Domain d1wcqc2: 1wcq C:506-647 [120901] Other proteins in same PDB: d1wcqa1, d1wcqa3, d1wcqb1, d1wcqb3, d1wcqc1, d1wcqc3 automatically matched to d1eut_2 complexed with dan, gol, na; mutant |
PDB Entry: 1wcq (more details), 2.1 Å
SCOP Domain Sequences for d1wcqc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wcqc2 b.18.1.1 (C:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv alseqtghkyaavaelevegqr
Timeline for d1wcqc2: