Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (23 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Sialidase, "linker" domain [49237] (1 species) follows the catalytic six-bladed beta-propeller domain |
Species Micromonospora viridifaciens [TaxId:1881] [49238] (6 PDB entries) Uniprot Q02834 47-647 |
Domain d1wcqc1: 1wcq C:405-505 [120900] Other proteins in same PDB: d1wcqa2, d1wcqa3, d1wcqb2, d1wcqb3, d1wcqc2, d1wcqc3 automatically matched to d1eut_1 complexed with dan, gol, na; mutant |
PDB Entry: 1wcq (more details), 2.1 Å
SCOP Domain Sequences for d1wcqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wcqc1 b.1.18.2 (C:405-505) Sialidase, "linker" domain {Micromonospora viridifaciens [TaxId: 1881]} capftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqak gqvtitvpagttpgryrvgatlrtsagnasttftvtvglld
Timeline for d1wcqc1: