Lineage for d1vfla1 (1vfl A:1-349)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 816850Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 816851Family c.1.9.1: Adenosine/AMP deaminase [51557] (2 proteins)
  6. 816852Protein Adenosine deaminase (ADA) [51558] (3 species)
    Common fold covers the whole protein structure
  7. 816853Species Cow (Bos taurus) [TaxId:9913] [82257] (17 PDB entries)
    Uniprot P56658 3-350
    Uniprot P56658
    Uniprot P56658 3-350 ! Uniprot P56658
  8. 816854Domain d1vfla1: 1vfl A:1-349 [120041]
    automatically matched to d1ndva_
    complexed with zn

Details for d1vfla1

PDB Entry: 1vfl (more details), 1.8 Å

PDB Description: Adenosine deaminase
PDB Compounds: (A:) adenosine deaminase

SCOP Domain Sequences for d1vfla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfla1 c.1.9.1 (A:1-349) Adenosine deaminase (ADA) {Cow (Bos taurus) [TaxId: 9913]}
tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdfla
kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr

SCOP Domain Coordinates for d1vfla1:

Click to download the PDB-style file with coordinates for d1vfla1.
(The format of our PDB-style files is described here.)

Timeline for d1vfla1: