Lineage for d1vfla_ (1vfl A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833367Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins)
  6. 2833415Protein automated matches [190078] (5 species)
    not a true protein
  7. 2833416Species Cow (Bos taurus) [TaxId:9913] [186799] (5 PDB entries)
  8. 2833417Domain d1vfla_: 1vfl A: [120041]
    automated match to d1w1ie_
    complexed with zn

Details for d1vfla_

PDB Entry: 1vfl (more details), 1.8 Å

PDB Description: Adenosine deaminase
PDB Compounds: (A:) adenosine deaminase

SCOPe Domain Sequences for d1vfla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfla_ c.1.9.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdfla
kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr

SCOPe Domain Coordinates for d1vfla_:

Click to download the PDB-style file with coordinates for d1vfla_.
(The format of our PDB-style files is described here.)

Timeline for d1vfla_: