Lineage for d1vf8a2 (1vf8 A:246-315)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheet
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) 
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) 
Protein Chitinase-like lectin ym1 [64252] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [64253] (2 PDB entries) 
Domain d1vf8a2: 1vf8 A:246-315 [120030]
Other proteins in same PDB: d1vf8a1
automatically matched to d1e9la2
Details for d1vf8a2
PDB Entry: 1vf8 (more details), 1.31 Å
PDB Description: The Crystal Structure of Ym1 at 1.31 A Resolution
PDB Compounds: (A:) secretory proteinSCOP Domain Sequences for d1vf8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]}
yghtfilsdpsktgigaptistgppgkytdesgllayyevctflnegatevwdapqevpy
ayqgnewvgy
SCOP Domain Coordinates for d1vf8a2:
Click to download the PDB-style file with coordinates for d1vf8a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vf8a2:
- d1vf8a2 first appeared in SCOP 1.73
- d1vf8a2 appears in SCOPe 2.01
- d1vf8a2 appears in the current release, SCOPe 2.08
View in 3D
