Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) |
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
Protein Chitinase-like lectin ym1 [64252] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [64253] (2 PDB entries) |
Domain d1vf8a2: 1vf8 A:246-315 [120030] Other proteins in same PDB: d1vf8a1 automated match to d1e9la2 |
PDB Entry: 1vf8 (more details), 1.31 Å
SCOPe Domain Sequences for d1vf8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} yghtfilsdpsktgigaptistgppgkytdesgllayyevctflnegatevwdapqevpy ayqgnewvgy
Timeline for d1vf8a2: