Lineage for d1vf8a2 (1vf8 A:246-315)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720612Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 720613Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 720720Protein Chitinase-like lectin ym1 [64252] (1 species)
  7. 720721Species Mouse (Mus musculus) [TaxId:10090] [64253] (2 PDB entries)
  8. 720722Domain d1vf8a2: 1vf8 A:246-315 [120030]
    Other proteins in same PDB: d1vf8a1
    automatically matched to d1e9la2

Details for d1vf8a2

PDB Entry: 1vf8 (more details), 1.31 Å

PDB Description: The Crystal Structure of Ym1 at 1.31 A Resolution
PDB Compounds: (A:) secretory protein

SCOP Domain Sequences for d1vf8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]}
yghtfilsdpsktgigaptistgppgkytdesgllayyevctflnegatevwdapqevpy
ayqgnewvgy

SCOP Domain Coordinates for d1vf8a2:

Click to download the PDB-style file with coordinates for d1vf8a2.
(The format of our PDB-style files is described here.)

Timeline for d1vf8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vf8a1