SCOP 1.73: Domain d1vf8a2: 1vf8 A:246-315

Lineage for d1vf8a2 (1vf8 A:246-315)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitinase-like lectin ym1 [64252] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [64253] (2 PDB entries)

8. Domain d1vf8a2: 1vf8 A:246-315 [120030]
   Other proteins in same PDB: d1vf8a1
   automatically matched to d1e9la2

Details for d1vf8a2

PDB Entry: 1vf8, 1.31 Å

PDB Description: The Crystal Structure of Ym1 at 1.31 A Resolution

PDB Compounds: (A:) secretory protein

SCOP Domain Sequences for d1vf8a2:

Sequence; same for both SEQRES and ATOM records:

>d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]}
yghtfilsdpsktgigaptistgppgkytdesgllayyevctflnegatevwdapqevpy
ayqgnewvgy

Timeline for d1vf8a2:

• d1vf8a2 is new in SCOP 1.73
  
• d1vf8a2 appears in SCOP 1.75
  
• d1vf8a2 appears in the current release, SCOPe 2.08