Lineage for d1y88a2 (1y88 A:3-127)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the restSuperfamily c.52.1: Restriction endonuclease-like [52980] (33 families) 
Family c.52.1.30: MRR-like [117638] (1 protein)
Pfam PF04471Protein Hypothetical protein AF1548, N-terminal domain [117639] (1 species) Species Archaeoglobus fulgidus [TaxId:2234] [117640] (1 PDB entry)
SQ 28724
Domain d1y88a2: 1y88 A:3-127 [116561]
Other proteins in same PDB: d1y88a1
Structural genomics target
complexed with cl, so4
Details for d1y88a2
PDB Entry: 1y88 (more details), 1.85 Å
PDB Description: Crystal Structure of Protein of Unknown Function AF1548
PDB Compounds: (A:) Hypothetical protein AF1548SCOP Domain Sequences for d1y88a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y88a2 c.52.1.30 (A:3-127) Hypothetical protein AF1548, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
nlyfqghmvarlleehgfetktnvivqgncveqeidvvaerdgerymieckfhnipvytg
lkeamytyarfldvekhgftqpwiftntkfseeakkyagcvgikltgwsypekegievll
eskgl
SCOP Domain Coordinates for d1y88a2:
Click to download the PDB-style file with coordinates for d1y88a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1y88a2:
- d1y88a2 first appeared in SCOP 1.71
- d1y88a2 appears in SCOP 1.73
- d1y88a2 appears in SCOPe 2.01
- d1y88a2 appears in the current release, SCOPe 2.08
View in 3D
