Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (33 families) |
Family c.52.1.30: MRR-like [117638] (1 protein) Pfam PF04471 |
Protein Hypothetical protein AF1548, N-terminal domain [117639] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [117640] (1 PDB entry) SQ 28724 |
Domain d1y88a2: 1y88 A:3-127 [116561] Other proteins in same PDB: d1y88a1 Structural genomics target complexed with cl, so4 |
PDB Entry: 1y88 (more details), 1.85 Å
SCOP Domain Sequences for d1y88a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y88a2 c.52.1.30 (A:3-127) Hypothetical protein AF1548, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} nlyfqghmvarlleehgfetktnvivqgncveqeidvvaerdgerymieckfhnipvytg lkeamytyarfldvekhgftqpwiftntkfseeakkyagcvgikltgwsypekegievll eskgl
Timeline for d1y88a2: