Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (3 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.3: Chromo barrel domain [117157] (3 proteins) typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain |
Protein Probable histone acetyltransferase MYST1 [117158] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117159] (1 PDB entry) Uniprot Q9D1P2 49-169 |
Domain d1wgsa_: 1wgs A: [114622] Structural genomics target |
PDB Entry: 1wgs (more details)
SCOP Domain Sequences for d1wgsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} gssgssgepevtveigetylcrrpdstwhsaeviqsrvndqegreefyvhyvgfnrrlde wvdknrlaltktvkdavqknsekylselaeqperkitrnqkrkhdeinhvqktyaemdpt taalekesgpssg
Timeline for d1wgsa_: