SCOPe 2.08: Domain d1wgsa1: 1wgs A:8-127

Lineage for d1wgsa1 (1wgs A:8-127)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.3: Chromo barrel domain [117157] (4 proteins)
   typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain

6. Protein Probable histone acetyltransferase MYST1 [117158] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117159] (1 PDB entry)
   Uniprot Q9D1P2 49-169

8. Domain d1wgsa1: 1wgs A:8-127 [114622]
   Other proteins in same PDB: d1wgsa2, d1wgsa3
   Structural genomics target

Details for d1wgsa1

PDB Entry: 1wgs

PDB Description: Solution Structure of the Tudor Domain from Mouse Hypothetical Protein Homologous to Histone Acetyltransferase

PDB Compounds: (A:) MYST histone acetyltransferase 1

SCOPe Domain Sequences for d1wgsa1:

Sequence; same for both SEQRES and ATOM records:

>d1wgsa1 b.34.13.3 (A:8-127) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]}
epevtveigetylcrrpdstwhsaeviqsrvndqegreefyvhyvgfnrrldewvdknrl
altktvkdavqknsekylselaeqperkitrnqkrkhdeinhvqktyaemdpttaaleke

Timeline for d1wgsa1:

• d1wgsa1 first appeared in SCOP 1.71, called d1wgsa_
  
• d1wgsa1 appears in SCOPe 2.07