SCOP 1.71: Domain d1wgsa_: 1wgs A:

Lineage for d1wgsa_ (1wgs A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (3 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.3: Chromo barrel domain [117157] (1 protein)
   typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain

6. Protein Probable histone acetyltransferase MYST1 [117158] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117159] (1 PDB entry)

8. Domain d1wgsa_: 1wgs A: [114622]
   Structural genomics target

Details for d1wgsa_

PDB Entry: 1wgs

PDB Description: Solution Structure of the Tudor Domain from Mouse Hypothetical Protein Homologous to Histone Acetyltransferase

SCOP Domain Sequences for d1wgsa_:

Sequence; same for both SEQRES and ATOM records:

>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus)}
gssgssgepevtveigetylcrrpdstwhsaeviqsrvndqegreefyvhyvgfnrrlde
wvdknrlaltktvkdavqknsekylselaeqperkitrnqkrkhdeinhvqktyaemdpt
taalekesgpssg

Timeline for d1wgsa_:

• d1wgsa_ is new in SCOP 1.71
  
• d1wgsa_ appears in SCOP 1.73
  
• d1wgsa_ appears in the current release, SCOPe 2.08, called d1wgsa1