Lineage for d1wgsa_ (1wgs A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557280Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 557987Superfamily b.34.13: Chromo domain-like [54160] (3 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 558031Family b.34.13.3: Chromo barrel domain [117157] (1 protein)
    typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain
  6. 558032Protein Probable histone acetyltransferase MYST1 [117158] (1 species)
  7. 558033Species Mouse (Mus musculus) [TaxId:10090] [117159] (1 PDB entry)
  8. 558034Domain d1wgsa_: 1wgs A: [114622]
    Structural genomics target

Details for d1wgsa_

PDB Entry: 1wgs (more details)

PDB Description: Solution Structure of the Tudor Domain from Mouse Hypothetical Protein Homologous to Histone Acetyltransferase

SCOP Domain Sequences for d1wgsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus)}
gssgssgepevtveigetylcrrpdstwhsaeviqsrvndqegreefyvhyvgfnrrlde
wvdknrlaltktvkdavqknsekylselaeqperkitrnqkrkhdeinhvqktyaemdpt
taalekesgpssg

SCOP Domain Coordinates for d1wgsa_:

Click to download the PDB-style file with coordinates for d1wgsa_.
(The format of our PDB-style files is described here.)

Timeline for d1wgsa_: