Lineage for d1wf3a1 (1wf3 A:3-180)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (78 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein GTPase Era, N-terminal domain [52637] (2 species) Species Thermus thermophilus [TaxId:274] [117533] (1 PDB entry)
Uniprot Q5SM23
Domain d1wf3a1: 1wf3 A:3-180 [114574]
Other proteins in same PDB: d1wf3a2
Structural genomics target
complexed with gnp, gol, mg
Details for d1wf3a1
PDB Entry: 1wf3 (more details), 1.88 Å
PDB Description: Crystal structure of GTP-binding protein TT1341 from Thermus thermophilus HB8
PDB Compounds: (A:) GTP-binding proteinSCOP Domain Sequences for d1wf3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]}
ektysgfvaivgkpnvgkstllnnllgvkvapisprpqttrkrlrgiltegrrqivfvdt
pglhkpmdalgefmdqevyealadvnavvwvvdlrhpptpedelvaralkplvgkvpill
vgnkldaakypeeamkayhellpeaeprmlsalderqvaelkadllalmpegpffype
SCOP Domain Coordinates for d1wf3a1:
Click to download the PDB-style file with coordinates for d1wf3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wf3a1:
- d1wf3a1 first appeared in SCOP 1.71
- d1wf3a1 appears in SCOP 1.73
- d1wf3a1 appears in SCOPe 2.01
- d1wf3a1 appears in the current release, SCOPe 2.08
View in 3D
