SCOP 1.75: Domain d1wf3a2: 1wf3 A:181-298

Lineage for d1wf3a2 (1wf3 A:181-298)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein GTPase Era C-terminal domain [54818] (2 species)

7. Species Thermus thermophilus [TaxId:274] [117915] (1 PDB entry)
   Uniprot Q5SM23

8. Domain d1wf3a2: 1wf3 A:181-298 [114575]
   Other proteins in same PDB: d1wf3a1
   Structural genomics target
   complexed with gnp, gol, mg

Details for d1wf3a2

PDB Entry: 1wf3, 1.88 Å

PDB Description: Crystal structure of GTP-binding protein TT1341 from Thermus thermophilus HB8

PDB Compounds: (A:) GTP-binding protein

SCOP Domain Sequences for d1wf3a2:

Sequence; same for both SEQRES and ATOM records:

>d1wf3a2 d.52.3.1 (A:181-298) GTPase Era C-terminal domain {Thermus thermophilus [TaxId: 274]}
dyaksdqtfgewvaeilreeamkrlwhevpyavatkveevaerengvlyikailyverps
qkaivigeggrkikeigqatrkqleallgkkvyldlevkvypdwrkdpealrelgyrs

Timeline for d1wf3a2:

• d1wf3a2 first appeared in SCOP 1.71
  
• d1wf3a2 appears in SCOP 1.73
  
• d1wf3a2 appears in SCOPe 2.01
  
• d1wf3a2 appears in the current release, SCOPe 2.08