SCOPe 2.08: Domain d1wf3a1: 1wf3 A:3-180

Lineage for d1wf3a1 (1wf3 A:3-180)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein GTPase Era, N-terminal domain [52637] (3 species)

7. Species Thermus thermophilus [TaxId:274] [117533] (2 PDB entries)
   Uniprot Q5SM23

8. Domain d1wf3a1: 1wf3 A:3-180 [114574]
   Other proteins in same PDB: d1wf3a2
   Structural genomics target
   complexed with gnp, gol, mg

Details for d1wf3a1

PDB Entry: 1wf3, 1.88 Å

PDB Description: Crystal structure of GTP-binding protein TT1341 from Thermus thermophilus HB8

PDB Compounds: (A:) GTP-binding protein

SCOPe Domain Sequences for d1wf3a1:

Sequence; same for both SEQRES and ATOM records:

>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]}
ektysgfvaivgkpnvgkstllnnllgvkvapisprpqttrkrlrgiltegrrqivfvdt
pglhkpmdalgefmdqevyealadvnavvwvvdlrhpptpedelvaralkplvgkvpill
vgnkldaakypeeamkayhellpeaeprmlsalderqvaelkadllalmpegpffype

Timeline for d1wf3a1:

• d1wf3a1 first appeared in SCOP 1.71
  
• d1wf3a1 appears in SCOPe 2.07