Lineage for d1wkqa_ (1wkq A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the restSuperfamily c.97.1: Cytidine deaminase-like [53927] (5 families) 
contains extra C-terminal strand 5, order 21345Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (7 proteins)
strand 5 is parallel to strand 4
Protein Guanine deaminase GuaD [110765] (1 species) Species Bacillus subtilis [TaxId:1423] [110766] (2 PDB entries)
Uniprot O34598
Domain d1wkqa_: 1wkq A: [109393]
Details for d1wkqa_
PDB Entry: 1wkq (more details), 1.17 Å
PDB Description: Crystal Structure of Bacillus subtilis Guanine Deaminase. The first domain-swapped structure in the cytidine deaminase superfamily
PDB Compounds: (A:) guanine deaminaseSCOP Domain Sequences for d1wkqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wkqa_ c.97.1.2 (A:) Guanine deaminase GuaD {Bacillus subtilis [TaxId: 1423]}
hamnhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevta
irkackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiy
keidkpaeertipfyqvtltehlspfqawrnfankkey
SCOP Domain Coordinates for d1wkqa_:
Click to download the PDB-style file with coordinates for d1wkqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wkqa_:
- d1wkqa_ first appeared in SCOP 1.69
- d1wkqa_ appears in SCOP 1.73
- d1wkqa_ appears in SCOPe 2.01
- d1wkqa_ appears in the current release, SCOPe 2.08, called d1wkqa1
View in 3D
