Lineage for d1uara1 (1uar A:2-144)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (4 families) 
Pfam PF00581
the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins)
duplication: consists of two domains of this fold
Protein Sulfurtransferase [52830] (2 species) 
Species Thermus thermophilus [TaxId:274] [110602] (1 PDB entry)
Uniprot Q5SJI0
Domain d1uara1: 1uar A:2-144 [107762]
Details for d1uara1
PDB Entry: 1uar (more details), 1.7 Å
PDB Description: crystal structure of rhodanese from thermus thermophilus hb8
PDB Compounds: (A:) rhodaneseSCOP Domain Sequences for d1uara1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]}
gyahpevlvstdwvqehledpkvrvlevdedillydtghipgaqkidwqrdfwdpvvrdf
iseeefaklmerlgisndttvvlygdknnwwaayafwffkynghkdvrlmnggrqkwvee
grplttevpsyppgryevpyrde
SCOP Domain Coordinates for d1uara1:
Click to download the PDB-style file with coordinates for d1uara1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uara1:
- d1uara1 first appeared in SCOP 1.69
- d1uara1 appears in SCOP 1.73
- d1uara1 appears in SCOPe 2.01
- d1uara1 appears in the current release, SCOPe 2.08
View in 3D
