Lineage for d1uara2 (1uar A:145-285)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833370Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 833371Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (4 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 833399Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins)
    duplication: consists of two domains of this fold
  6. 833425Protein Sulfurtransferase [52830] (2 species)
  7. 833433Species Thermus thermophilus [TaxId:274] [110602] (1 PDB entry)
    Uniprot Q5SJI0
  8. 833435Domain d1uara2: 1uar A:145-285 [107763]
    complexed with gol

Details for d1uara2

PDB Entry: 1uar (more details), 1.7 Å

PDB Description: crystal structure of rhodanese from thermus thermophilus hb8
PDB Compounds: (A:) rhodanese

SCOP Domain Sequences for d1uara2:

Sequence, based on SEQRES records: (download)

>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]}
sirayrddvlehiikvkegkgalvdvrspqeyrgelthmpdypqegalraghipgaknip
wakavnpdgtfksaeelralyeplgitkdkdivvycriaersshswfvlkyllgyphvkn
ydgswtewgnlvgvpiakgee

Sequence, based on observed residues (ATOM records): (download)

>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]}
sirayrddvlehiikvkegkgalvdvrspqeyrgelegalraghipgaknipwakavnpd
gtfksaeelralyeplgitkdkdivvycriaersshswfvlkyllgyphvknydgswtew
gnlvgvpiakgee

SCOP Domain Coordinates for d1uara2:

Click to download the PDB-style file with coordinates for d1uara2.
(The format of our PDB-style files is described here.)

Timeline for d1uara2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uara1