SCOPe 2.08: Domain d1uara2: 1uar A:145-285

Lineage for d1uara2 (1uar A:145-285)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein Sulfurtransferase [52830] (2 species)

7. Species Thermus thermophilus [TaxId:274] [110602] (1 PDB entry)
   Uniprot Q5SJI0

8. Domain d1uara2: 1uar A:145-285 [107763]
   complexed with gol

Details for d1uara2

PDB Entry: 1uar, 1.7 Å

PDB Description: crystal structure of rhodanese from thermus thermophilus hb8

PDB Compounds: (A:) rhodanese

SCOPe Domain Sequences for d1uara2:

Sequence, based on SEQRES records:

>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]}
sirayrddvlehiikvkegkgalvdvrspqeyrgelthmpdypqegalraghipgaknip
wakavnpdgtfksaeelralyeplgitkdkdivvycriaersshswfvlkyllgyphvkn
ydgswtewgnlvgvpiakgee

Sequence, based on observed residues (ATOM records):

>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]}
sirayrddvlehiikvkegkgalvdvrspqeyrgelegalraghipgaknipwakavnpd
gtfksaeelralyeplgitkdkdivvycriaersshswfvlkyllgyphvknydgswtew
gnlvgvpiakgee

Timeline for d1uara2:

• d1uara2 first appeared in SCOP 1.69
  
• d1uara2 appears in SCOPe 2.07