| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) ![]() Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
| Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (5 proteins) duplication: consists of two domains of this fold |
| Protein Sulfurtransferase [52830] (2 species) |
| Species Thermus thermophilus [TaxId:274] [110602] (1 PDB entry) Uniprot Q5SJI0 |
| Domain d1uara1: 1uar A:2-144 [107762] complexed with gol |
PDB Entry: 1uar (more details), 1.7 Å
SCOPe Domain Sequences for d1uara1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]}
gyahpevlvstdwvqehledpkvrvlevdedillydtghipgaqkidwqrdfwdpvvrdf
iseeefaklmerlgisndttvvlygdknnwwaayafwffkynghkdvrlmnggrqkwvee
grplttevpsyppgryevpyrde
Timeline for d1uara1: