Lineage for d1uara1 (1uar A:2-144)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876007Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2876008Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 2876043Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2876069Protein Sulfurtransferase [52830] (2 species)
  7. 2876077Species Thermus thermophilus [TaxId:274] [110602] (1 PDB entry)
    Uniprot Q5SJI0
  8. 2876078Domain d1uara1: 1uar A:2-144 [107762]
    complexed with gol

Details for d1uara1

PDB Entry: 1uar (more details), 1.7 Å

PDB Description: crystal structure of rhodanese from thermus thermophilus hb8
PDB Compounds: (A:) rhodanese

SCOPe Domain Sequences for d1uara1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]}
gyahpevlvstdwvqehledpkvrvlevdedillydtghipgaqkidwqrdfwdpvvrdf
iseeefaklmerlgisndttvvlygdknnwwaayafwffkynghkdvrlmnggrqkwvee
grplttevpsyppgryevpyrde

SCOPe Domain Coordinates for d1uara1:

Click to download the PDB-style file with coordinates for d1uara1.
(The format of our PDB-style files is described here.)

Timeline for d1uara1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uara2