Lineage for d1u3em1 (1u3e M:1-105)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 851833Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 851834Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 851892Family d.4.1.3: Intron-encoded homing endonucleases [54069] (2 proteins)
  6. 851893Protein Intron-encoded homing endonuclease I-HmuI [110776] (1 species)
  7. 851894Species Bacteriophage SP01 [TaxId:10685] [110777] (1 PDB entry)
    Uniprot P34081
  8. 851895Domain d1u3em1: 1u3e M:1-105 [107640]
    Other proteins in same PDB: d1u3em2
    complexed with egl, mn, sr, trs

Details for d1u3em1

PDB Entry: 1u3e (more details), 2.92 Å

PDB Description: DNA binding and cleavage by the HNH homing endonuclease I-HmuI
PDB Compounds: (M:) HNH homing endonuclease

SCOP Domain Sequences for d1u3em1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3em1 d.4.1.3 (M:1-105) Intron-encoded homing endonuclease I-HmuI {Bacteriophage SP01 [TaxId: 10685]}
mewkdikgyeghyqvsntgevysiksgktlkhqipkdgyhriglfkggkgktfqvhrlva
ihfcegyeeglvvdhkdgnkdnnlstnlrwvtqkinvenqmsrgt

SCOP Domain Coordinates for d1u3em1:

Click to download the PDB-style file with coordinates for d1u3em1.
(The format of our PDB-style files is described here.)

Timeline for d1u3em1:

851895
d1u3em1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1u3em2