![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
![]() | Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) ![]() common motif contains conserved histidine residue and metal-binding site |
![]() | Family d.4.1.3: Intron-encoded homing endonucleases [54069] (2 proteins) |
![]() | Protein Intron-encoded homing endonuclease I-HmuI [110776] (1 species) |
![]() | Species Bacteriophage SP01 [TaxId:10685] [110777] (1 PDB entry) |
![]() | Domain d1u3em1: 1u3e M:1-105 [107640] Other proteins in same PDB: d1u3em2 |
PDB Entry: 1u3e (more details), 2.92 Å
SCOP Domain Sequences for d1u3em1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3em1 d.4.1.3 (M:1-105) Intron-encoded homing endonuclease I-HmuI {Bacteriophage SP01} mewkdikgyeghyqvsntgevysiksgktlkhqipkdgyhriglfkggkgktfqvhrlva ihfcegyeeglvvdhkdgnkdnnlstnlrwvtqkinvenqmsrgt
Timeline for d1u3em1: