SCOP 1.75: Domain d1u3em2: 1u3e M:106-174

Lineage for d1u3em2 (1u3e M:106-174)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.285: DNA-binding domain of intron-encoded endonucleases [64495] (1 superfamily)
   beta(2)-alpha(2)-beta; 2 layers; 3-stranded antiparallel beta-sheet, order 213; HTH motif; also includes the extra N-terminal, DNA minor groove-binding helix

4. Superfamily d.285.1: DNA-binding domain of intron-encoded endonucleases [64496] (1 family)

5. Family d.285.1.1: DNA-binding domain of intron-encoded endonucleases [64497] (2 proteins)

6. Protein Intron-encoded homing endonuclease I-HmuI [110794] (1 species)

7. Species Bacteriophage SP01 [TaxId:10685] [110795] (1 PDB entry)
   Uniprot P34081

8. Domain d1u3em2: 1u3e M:106-174 [107641]
   Other proteins in same PDB: d1u3em1
   complexed with egl, mn, sr, trs

Details for d1u3em2

PDB Entry: 1u3e, 2.92 Å

PDB Description: DNA binding and cleavage by the HNH homing endonuclease I-HmuI

PDB Compounds: (M:) HNH homing endonuclease

SCOP Domain Sequences for d1u3em2:

Sequence; same for both SEQRES and ATOM records:

>d1u3em2 d.285.1.1 (M:106-174) Intron-encoded homing endonuclease I-HmuI {Bacteriophage SP01 [TaxId: 10685]}
lnvskaqqiakiknqkpiivispdgiekeypstkcaceelgltrgkvtdvlkghrihhkg
ytfryklng

Timeline for d1u3em2:

• d1u3em2 first appeared in SCOP 1.69
  
• d1u3em2 appears in SCOP 1.73
  
• d1u3em2 appears in SCOPe 2.01
  
• d1u3em2 appears in the current release, SCOPe 2.08