Lineage for d1vhsa_ (1vhs A:)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
3 layers: a/b/a; contains mixed beta-sheetSuperfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families) 
Family d.108.1.1: N-acetyl transferase, NAT [55730] (57 proteins) 
Protein Putative phosphinothricin acetyltransferase YwnH [103171] (1 species) Species Bacillus subtilis [TaxId:1423] [103172] (1 PDB entry) 
Domain d1vhsa_: 1vhs A: [100698]
structural genomics
Details for d1vhsa_
PDB Entry: 1vhs (more details), 1.8 Å
PDB Description: crystal structure of a putative phosphinothricin n-acetyltransferase
PDB Compounds: (A:) similar to phosphinothricin acetyltransferaseSCOP Domain Sequences for d1vhsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]}
sltlrlaehrdleavvaiynstiasrmvtadtepvtpedrmewfsghtesrplyvaeden
gnvaawisfetfygrpaynktaevsiyideacrgkgvgsyllqealriapnlgirslmaf
ifghnkpslklfekhgfaewglfpgiaemdgkrydlkilgrelse
SCOP Domain Coordinates for d1vhsa_:
Click to download the PDB-style file with coordinates for d1vhsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vhsa_:
- d1vhsa_ first appeared in SCOP 1.67
- d1vhsa_ appears in SCOP 1.73
- d1vhsa_ appears in SCOPe 2.01
- d1vhsa_ appears in the current release, SCOPe 2.08, called d1vhsa1
View in 3D
