Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (57 proteins) |
Protein Putative phosphinothricin acetyltransferase YwnH [103171] (1 species) |
Species Bacillus subtilis [TaxId:1423] [103172] (1 PDB entry) |
Domain d1vhsa_: 1vhs A: [100698] structural genomics |
PDB Entry: 1vhs (more details), 1.8 Å
SCOP Domain Sequences for d1vhsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} sltlrlaehrdleavvaiynstiasrmvtadtepvtpedrmewfsghtesrplyvaeden gnvaawisfetfygrpaynktaevsiyideacrgkgvgsyllqealriapnlgirslmaf ifghnkpslklfekhgfaewglfpgiaemdgkrydlkilgrelse
Timeline for d1vhsa_: