PDB entry 8rnt

View 8rnt on RCSB PDB site
Description: structure of ribonuclease t1 complexed with zinc(ii) at 1.8 angstroms resolution: a zn2+.6h2o.carboxylate clathrate
Deposited on 1991-09-23, released 1993-01-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.14
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d8rnt__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >8rnt_ (-)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect