PDB entry 7rnt

View 7rnt on RCSB PDB site
Description: crystal structure of the tyr45trp mutant of ribonuclease t1 in a complex with 2'-adenylic acid
Deposited on 1991-08-20, released 1993-01-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d7rnt__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7rnt_ (-)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnwegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect