PDB entry 7gsp

View 7gsp on RCSB PDB site
Description: ribonuclease t1/2',3'-cgps, non-productive
Deposited on 1997-12-10, released 1998-03-18
The last revision prior to the SCOP 1.55 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d7gspa_
  • Chain 'B':
    Domains in SCOP 1.55: d7gspb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7gspA (A:)
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7gspB (B:)
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect