SCOPe 2.08: Structural Classification of Proteins

PDB entry 6o65

View 6o65 on RCSB PDB site
Description: Crystal Structure of Arabidopsis thaliana Spermidine Synthase isoform 1 (AtSPDS1) in complex with decarboxylated S-adenosylmethionine and cyclohexylamine
Class: transferase
Keywords: Polyamine metabolism, Putrescine Biosynthesis, Transferase, dc-SAM, MTA
Deposited on 2019-03-05, released 2019-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Spermidine synthase 1
Species: Arabidopsis thaliana [TaxId:3702]
Gene: SPDSYN1, At1g23820, F5O8.38
Database cross-references and differences (RAF-indexed):
- Uniprot Q9ZUB3
Domains in SCOPe 2.08: d6o65a_
Chain 'B':
Compound: Spermidine synthase 1
Species: Arabidopsis thaliana [TaxId:3702]
Gene: SPDSYN1, At1g23820, F5O8.38
Database cross-references and differences (RAF-indexed):
- Uniprot Q9ZUB3 (3-End)
  - expression tag (0-2)
Domains in SCOPe 2.08: d6o65b1, d6o65b2
Chain 'C':
Compound: Spermidine synthase 1
Species: Arabidopsis thaliana [TaxId:3702]
Gene: SPDSYN1, At1g23820, F5O8.38
Database cross-references and differences (RAF-indexed):
- Uniprot Q9ZUB3
Domains in SCOPe 2.08: d6o65c_
Chain 'D':
Compound: Spermidine synthase 1
Species: Arabidopsis thaliana [TaxId:3702]
Gene: SPDSYN1, At1g23820, F5O8.38
Database cross-references and differences (RAF-indexed):
- Uniprot Q9ZUB3 (3-End)
  - expression tag (0-2)
Domains in SCOPe 2.08: d6o65d1, d6o65d2
Chain 'E':
Compound: Spermidine synthase 1
Species: Arabidopsis thaliana [TaxId:3702]
Gene: SPDSYN1, At1g23820, F5O8.38
Database cross-references and differences (RAF-indexed):
- Uniprot Q9ZUB3
Domains in SCOPe 2.08: d6o65e_
Chain 'F':
Compound: Spermidine synthase 1
Species: Arabidopsis thaliana [TaxId:3702]
Gene: SPDSYN1, At1g23820, F5O8.38
Database cross-references and differences (RAF-indexed):
- Uniprot Q9ZUB3 (3-End)
  - expression tag (0-2)
Domains in SCOPe 2.08: d6o65f1, d6o65f2
Chain 'G':
Compound: Spermidine synthase 1
Species: Arabidopsis thaliana [TaxId:3702]
Gene: SPDSYN1, At1g23820, F5O8.38
Database cross-references and differences (RAF-indexed):
- Uniprot Q9ZUB3
Domains in SCOPe 2.08: d6o65g_
Chain 'H':
Compound: Spermidine synthase 1
Species: Arabidopsis thaliana [TaxId:3702]
Gene: SPDSYN1, At1g23820, F5O8.38
Database cross-references and differences (RAF-indexed):
- Uniprot Q9ZUB3 (3-End)
  - expression tag (0-2)
Domains in SCOPe 2.08: d6o65h1, d6o65h2
Heterogens: S4M, HAI, SO4, PEG, EDO, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>6o65A (A:)
snakkepacfstvipgwfsemspmwpgeahslkvekvlfqgksdyqdvivfqsatygkvl
vldgviqlterdecayqemithlplcsipnpkkvlvigggdggvlrevarhasieqidmc
eidkmvvdvskqffpdvaigyedprvnlvigdgvaflknaaegsydavivdssdpigpak
elfekpffqsvaralrpggvvctqaeslwlhmdiiedivsncreifkgsvnyawtsvpty
psgvigfmlcstegpdvdfkhplnpidesssksngplkfynaeihsaafclpsfakkvie
skan