Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.17: Spermidine synthase [69557] (3 proteins) contains additional N-terminal tetramerisation all-beta domain, res. 1-71 |
Protein Spermidine synthase [69558] (6 species) polyamine aminopropyltransferase |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117680] (4 PDB entries) Uniprot Q9ZUB3 |
Domain d6o65g_: 6o65 G: [371070] Other proteins in same PDB: d6o65b2, d6o65d2, d6o65f2, d6o65h2 automated match to d1xj5b_ complexed with edo, hai, peg, s4m, so4 |
PDB Entry: 6o65 (more details), 1.8 Å
SCOPe Domain Sequences for d6o65g_:
Sequence, based on SEQRES records: (download)
>d6o65g_ c.66.1.17 (G:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} kepacfstvipgwfsemspmwpgeahslkvekvlfqgksdyqdvivfqsatygkvlvldg viqlterdecayqemithlplcsipnpkkvlvigggdggvlrevarhasieqidmceidk mvvdvskqffpdvaigyedprvnlvigdgvaflknaaegsydavivdssdpigpakelfe kpffqsvaralrpggvvctqaeslwlhmdiiedivsncreifkgsvnyawtsvptypsgv igfmlcstegpdvdfkhplnpidesssksngplkfynaeihsaafclpsfakkvies
>d6o65g_ c.66.1.17 (G:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} kepacfstvipgwfsemspmwpgeahslkvekvlfqgksdyqdvivfqsatygkvlvldg viqlterdecayqemithlplcsipnpkkvlvigggdggvlrevarhasieqidmceidk mvvdvskqffpdvaigyedprvnlvigdgvaflknaaegsydavivdssdpigpakelfe kpffqsvaralrpggvvctqaeslwlhmdiiedivsncreifkgsvnyawtsvptypsgv igfmlcstegpdvdfkhplnpigplkfynaeihsaafclpsfakkvies
Timeline for d6o65g_: