PDB entry 6jep

View 6jep on RCSB PDB site
Description: Structure of a neutralizing antibody bound to the Zika envelope protein domain III
Class: antiviral protein
Keywords: Antibody, complex, ANTIVIRAL PROTEIN
Deposited on 2019-02-07, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Genome polyprotein
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jepe_
  • Chain 'F':
    Compound: Genome polyprotein
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jepf_
  • Chain 'H':
    Compound: heavy chain of Fab ZK2B10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JEP (0-234)
  • Chain 'I':
    Compound: light chain of Fab ZK2B10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JEP (0-213)
    Domains in SCOPe 2.07: d6jepi1, d6jepi2
  • Chain 'K':
    Compound: heavy chain of Fab ZK2B10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JEP (0-234)
  • Chain 'L':
    Compound: light chain of Fab ZK2B10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JEP (0-213)
    Domains in SCOPe 2.07: d6jepl1, d6jepl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6jepE (E:)
    vsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitan
    pvitestenskmmleldppfgdsyivigvgekkithhwhrs
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6jepF (F:)
    vsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitan
    pvitestenskmmleldppfgdsyivigvgekkithhwhrs
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6jepI (I:)
    syeltqppsasgtpgqrvtiscsgsssnignnyvhwyqqlpgsapklliyrnnqrpsgvp
    drfsgsksgtsgslaisglrsedeadyycaswddslsghwvfgggtkvtvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6jepL (L:)
    syeltqppsasgtpgqrvtiscsgsssnignnyvhwyqqlpgsapklliyrnnqrpsgvp
    drfsgsksgtsgslaisglrsedeadyycaswddslsghwvfgggtkvtvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapt