SCOPe 2.07: Domain d6jepf_: 6jep F:

Lineage for d6jepf_ (6jep F:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein automated matches [190183] (10 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [320471] (7 PDB entries)

8. Domain d6jepf_: 6jep F: [368897]
   Other proteins in same PDB: d6jepi1, d6jepi2, d6jepl1, d6jepl2
   automated match to d5omza_

Details for d6jepf_

PDB Entry: 6jep, 2.32 Å

PDB Description: structure of a neutralizing antibody bound to the zika envelope protein domain iii

PDB Compounds: (F:) Genome polyprotein

SCOPe Domain Sequences for d6jepf_:

Sequence; same for both SEQRES and ATOM records:

>d6jepf_ b.1.18.4 (F:) automated matches {Zika virus [TaxId: 64320]}
vsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitan
pvitestenskmmleldppfgdsyivigvgekkithhwhrs

Timeline for d6jepf_:

• d6jepf_ is new in SCOPe 2.07-stable
  
• d6jepf_ appears in the current release, SCOPe 2.08