PDB entry 6j9o
View 6j9o on RCSB PDB site
Description: Crystal structure of a free scFv molecule from a group 2 influenza A viruses HA binding antibody AF4H1K1
Class: antiviral protein
Keywords: a free scFv molecule, AF4H1K1, influenza A viruses, HA binding antibody, ANTIVIRAL PROTEIN
Deposited on
2019-01-23, released
2020-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated
2021-02-10, with a file datestamp of
2021-02-05.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.61
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'H':
Compound: Heavy chain of AF4H1K1 scFv
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6j9oh_ - Chain 'L':
Compound: Light chain of AF4H1K1 scFv
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6j9ol_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>6j9oH (H:)
gsqvqlvesgggvvqpgtslrlsceasgftssayamhwvrqapgkglewvavitfdggyq
yyadsvkgrftisrdisrntlhlhmnslraedtavyycardpltkllpfdwvsggyfdyw
gqgtlvtvss
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>6j9oL (L:)
divmtqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliyrassratgip
drfsgsgsgtdftltisrlepedfavyycqqygssftfgqgtkveikr