SCOPe 2.08: Domain d6j9ol_: 6j9o L:

Lineage for d6j9ol_ (6j9o L:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6j9ol_: 6j9o L: [379451]
   Other proteins in same PDB: d6j9oh_
   automated match to d4lrnl_

Details for d6j9ol_

PDB Entry: 6j9o, 1.4 Å

PDB Description: crystal structure of a free scfv molecule from a group 2 influenza a viruses ha binding antibody af4h1k1

PDB Compounds: (L:) Light chain of AF4H1K1 scFv

SCOPe Domain Sequences for d6j9ol_:

Sequence; same for both SEQRES and ATOM records:

>d6j9ol_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliyrassratgip
drfsgsgsgtdftltisrlepedfavyycqqygssftfgqgtkveikr

Timeline for d6j9ol_:

• d6j9ol_ first appeared in SCOPe 2.07