Lineage for d6j9oh_ (6j9o H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742223Domain d6j9oh_: 6j9o H: [379481]
    Other proteins in same PDB: d6j9ol_
    automated match to d4kfzc_

Details for d6j9oh_

PDB Entry: 6j9o (more details), 1.4 Å

PDB Description: crystal structure of a free scfv molecule from a group 2 influenza a viruses ha binding antibody af4h1k1
PDB Compounds: (H:) Heavy chain of AF4H1K1 scFv

SCOPe Domain Sequences for d6j9oh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j9oh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsqvqlvesgggvvqpgtslrlsceasgftssayamhwvrqapgkglewvavitfdggyq
yyadsvkgrftisrdisrntlhlhmnslraedtavyycardpltkllpfdwvsggyfdyw
gqgtlvtvss

SCOPe Domain Coordinates for d6j9oh_:

Click to download the PDB-style file with coordinates for d6j9oh_.
(The format of our PDB-style files is described here.)

Timeline for d6j9oh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6j9ol_