PDB entry 6fs7

View 6fs7 on RCSB PDB site
Description: Influenza A/California/04/2009 (pH1N1) endonuclease with I38T mutation with bound inhibitor, baloxavir acid (BXA)
Class: viral protein
Keywords: Influenza, endonuclease, inhibitor, VIRAL PROTEIN
Deposited on 2018-02-19, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase acidic protein,Polymerase acidic protein
    Species: Influenza A virus (A/California/04/2009(H1N1)) [TaxId:641501]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S0 (7-57)
      • expression tag (2-6)
      • engineered mutation (44)
    • Uniprot C3W5S0 (Start-192)
    Domains in SCOPe 2.07: d6fs7a1, d6fs7a2
  • Chain 'B':
    Compound: Polymerase acidic protein,Polymerase acidic protein
    Species: Influenza A virus (A/California/04/2009(H1N1)) [TaxId:641501]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S0 (7-End)
      • expression tag (1-6)
      • engineered mutation (44)
    • Uniprot C3W5S0 (Start-192)
    Domains in SCOPe 2.07: d6fs7b1, d6fs7b2
  • Chain 'C':
    Compound: Polymerase acidic protein,Polymerase acidic protein
    Species: Influenza A virus (A/California/04/2009(H1N1)) [TaxId:641501]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S0 (7-End)
      • expression tag (3-6)
      • engineered mutation (44)
    • Uniprot C3W5S0 (Start-192)
    Domains in SCOPe 2.07: d6fs7c1, d6fs7c2
  • Chain 'D':
    Compound: Polymerase acidic protein,Polymerase acidic protein
    Species: Influenza A virus (A/California/04/2009(H1N1)) [TaxId:641501]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S0 (7-57)
      • expression tag (4-6)
      • engineered mutation (44)
    • Uniprot C3W5S0 (Start-192)
    Domains in SCOPe 2.07: d6fs7d1, d6fs7d2
  • Chain 'E':
    Compound: Polymerase acidic protein,Polymerase acidic protein
    Species: Influenza A virus (A/California/04/2009(H1N1)) [TaxId:641501]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S0 (7-End)
      • expression tag (4-6)
      • engineered mutation (44)
    • Uniprot C3W5S0 (Start-192)
    Domains in SCOPe 2.07: d6fs7e1, d6fs7e2
  • Chain 'F':
    Compound: Polymerase acidic protein,Polymerase acidic protein
    Species: Influenza A virus (A/California/04/2009(H1N1)) [TaxId:641501]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S0 (7-57)
      • expression tag (4-6)
      • engineered mutation (44)
    • Uniprot C3W5S0 (Start-192)
    Domains in SCOPe 2.07: d6fs7f1, d6fs7f2
  • Heterogens: MN, E4Z, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fs7A (A:)
    gmgsgmamedfvrqcfnpmivelaekamkeygedpkietnkfaatcthlevcfmysdfgs
    gdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrr
    evhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirqemasr
    slwdsfrqserge
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fs7A (A:)
    gsgmamedfvrqcfnpmivelaekamkeygedpkietnkfaatcthlevcfmysdfkhrf
    eiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekan
    kiksekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqser
    ge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fs7B (B:)
    gmgsgmamedfvrqcfnpmivelaekamkeygedpkietnkfaatcthlevcfmysdfgs
    gdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrr
    evhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirqemasr
    slwdsfrqserge
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fs7B (B:)
    mgsgmamedfvrqcfnpmivelaekamkeygedpkietnkfaatcthlevcfmysdkhrf
    eiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekan
    kiksekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqser
    ge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fs7C (C:)
    gmgsgmamedfvrqcfnpmivelaekamkeygedpkietnkfaatcthlevcfmysdfgs
    gdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrr
    evhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirqemasr
    slwdsfrqserge
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fs7C (C:)
    sgmamedfvrqcfnpmivelaekamkeygedpkietnkfaatcthlevcfmysdlkhrfe
    iiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekank
    ikkthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqserge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fs7D (D:)
    gmgsgmamedfvrqcfnpmivelaekamkeygedpkietnkfaatcthlevcfmysdfgs
    gdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrr
    evhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirqemasr
    slwdsfrqserge
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fs7D (D:)
    gmamedfvrqcfnpmivelaekamkeygedpkietnkfaatcthlevcfmysdfkhrfei
    iegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekanki
    ksekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqserge
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6fs7E (E:)
    gmgsgmamedfvrqcfnpmivelaekamkeygedpkietnkfaatcthlevcfmysdfgs
    gdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrr
    evhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirqemasr
    slwdsfrqserge
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fs7E (E:)
    gmamedfvrqcfnpmivelaekamkeygedpkietnkfaatcthlevcfmysdlkhrfei
    iegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekanki
    kthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqserge
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6fs7F (F:)
    gmgsgmamedfvrqcfnpmivelaekamkeygedpkietnkfaatcthlevcfmysdfgs
    gdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrr
    evhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirqemasr
    slwdsfrqserge
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fs7F (F:)
    gmamedfvrqcfnpmivelaekamkeygedpkietnkfaatcthlevcfmysdfhrfeii
    egrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekankik
    sekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqserge