Lineage for d6fs7e1 (6fs7 E:1-198)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882703Family c.52.1.34: PA N-terminal domain [254166] (3 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 2882707Protein PA N-terminal domain [254375] (8 species)
  7. 2882737Species Influenza A virus [TaxId:93838] [254808] (91 PDB entries)
  8. 2882763Domain d6fs7e1: 6fs7 E:1-198 [354630]
    Other proteins in same PDB: d6fs7a2, d6fs7b2, d6fs7c2, d6fs7d2, d6fs7e2, d6fs7f2
    automated match to d4e5ea_
    complexed with e4z, mn; mutant

Details for d6fs7e1

PDB Entry: 6fs7 (more details), 1.96 Å

PDB Description: influenza a/california/04/2009 (ph1n1) endonuclease with i38t mutation with bound inhibitor, baloxavir acid (bxa)
PDB Compounds: (E:) Polymerase acidic protein,Polymerase acidic protein

SCOPe Domain Sequences for d6fs7e1:

Sequence, based on SEQRES records: (download)

>d6fs7e1 c.52.1.34 (E:1-198) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaatcthlevcfmysdfgsgdpnall
khrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyyl
ekankiksekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfr
qserge

Sequence, based on observed residues (ATOM records): (download)

>d6fs7e1 c.52.1.34 (E:1-198) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaatcthlevcfmysdlkhrfeiieg
rdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekankikth
ihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqserge

SCOPe Domain Coordinates for d6fs7e1:

Click to download the PDB-style file with coordinates for d6fs7e1.
(The format of our PDB-style files is described here.)

Timeline for d6fs7e1: