Lineage for d6fs7a1 (6fs7 A:1-198)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. Family c.52.1.34: PA N-terminal domain [254166] (3 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. Protein PA N-terminal domain [254375] (8 species)
  7. Species Influenza A virus [TaxId:93838] [254808] (91 PDB entries)
  8. Domain d6fs7a1: 6fs7 A:1-198 [354623]
    Other proteins in same PDB: d6fs7a2, d6fs7b2, d6fs7c2, d6fs7d2, d6fs7e2, d6fs7f2
    automated match to d4e5ea_
    complexed with e4z, mn; mutant

Details for d6fs7a1

PDB Entry: 6fs7 (more details), 1.96 Å

PDB Description: influenza a/california/04/2009 (ph1n1) endonuclease with i38t mutation with bound inhibitor, baloxavir acid (bxa)
PDB Compounds: (A:) Polymerase acidic protein,Polymerase acidic protein

SCOPe Domain Sequences for d6fs7a1:

Sequence, based on SEQRES records: (download)

>d6fs7a1 c.52.1.34 (A:1-198) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaatcthlevcfmysdfgsgdpnall
khrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyyl
ekankiksekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfr
qserge

Sequence, based on observed residues (ATOM records): (download)

>d6fs7a1 c.52.1.34 (A:1-198) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaatcthlevcfmysdfkhrfeiieg
rdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekankikse
kthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqserge

SCOPe Domain Coordinates for d6fs7a1 are not available.

Timeline for d6fs7a1:

Domains from same chain:
(mouse over for more information)
d6fs7a2
Domains from other chains:
(mouse over for more information)
d6fs7b1, d6fs7b2, d6fs7c1, d6fs7c2, d6fs7d1, d6fs7d2, d6fs7e1, d6fs7e2, d6fs7f1, d6fs7f2