PDB entry 6bpa

View 6bpa on RCSB PDB site
Description: Plasmodium vivax reticulocyte binding protein 2b (PvRBP2b) bound to monoclonal antibody 3E9
Class: cell invasion
Keywords: Plasmodium vivax, invasion, malaria, antibody complex, CELL INVASION
Deposited on 2017-11-22, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Reticulocyte binding protein 2, putative
    Species: Plasmodium vivax (strain Salvador I) [TaxId:126793]
    Gene: PVX_094255
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Monoclonal antibody 3E9 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BPA
  • Chain 'C':
    Compound: Monoclonal antibody 3E9 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BPA
    Domains in SCOPe 2.07: d6bpac1, d6bpac2
  • Chain 'D':
    Compound: Reticulocyte binding protein 2, putative
    Species: Plasmodium vivax (strain Salvador I) [TaxId:126793]
    Gene: PVX_094255
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Monoclonal antibody 3E9 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BPA
  • Chain 'F':
    Compound: Monoclonal antibody 3E9 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6BPA
    Domains in SCOPe 2.07: d6bpaf1, d6bpaf2
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6bpaC (C:)
    mtmfslalllsllllcvsdsraettvtqspaslsmalgekvtircitstdidddlnwyql
    kpgeppkllisegntlrpgvpsrfsssgygtdfvftienmlsedvadyyclqsdnlpltf
    gagtklelkradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqng
    vlnswtdqdskdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bpaC (C:)
    ettvtqspaslsmalgekvtircitstdidddlnwyqlkpgeppkllisegntlrpgvps
    rfsssgygtdfvftienmlsedvadyyclqsdnlpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6bpaF (F:)
    mtmfslalllsllllcvsdsraettvtqspaslsmalgekvtircitstdidddlnwyql
    kpgeppkllisegntlrpgvpsrfsssgygtdfvftienmlsedvadyyclqsdnlpltf
    gagtklelkradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqng
    vlnswtdqdskdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6bpaF (F:)
    ettvtqspaslsmalgekvtircitstdidddlnwyqlkpgeppkllisegntlrpgvps
    rfsssgygtdfvftienmlsedvadyyclqsdnlpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr