Lineage for d6bpac1 (6bpa C:23-129)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. Domain d6bpac1: 6bpa C:23-129 [353632]
    Other proteins in same PDB: d6bpab_, d6bpae_
    automated match to d2g2ra1
    complexed with br

Details for d6bpac1

PDB Entry: 6bpa (more details), 2.53 Å

PDB Description: plasmodium vivax reticulocyte binding protein 2b (pvrbp2b) bound to monoclonal antibody 3e9
PDB Compounds: (C:) Monoclonal antibody 3E9 Fab light chain

SCOPe Domain Sequences for d6bpac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bpac1 b.1.1.0 (C:23-129) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ettvtqspaslsmalgekvtircitstdidddlnwyqlkpgeppkllisegntlrpgvps
rfsssgygtdfvftienmlsedvadyyclqsdnlpltfgagtklelk

SCOPe Domain Coordinates for d6bpac1 are not available.

Timeline for d6bpac1:

Domains from same chain:
(mouse over for more information)
d6bpac2
Domains from other chains:
(mouse over for more information)
d6bpab_, d6bpae_, d6bpaf1, d6bpaf2