Lineage for d6bpac2 (6bpa C:130-234)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (29 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 3053572Domain d6bpac2: 6bpa C:130-234 [353634]
    automated match to d3mbxl2
    complexed with br

Details for d6bpac2

PDB Entry: 6bpa (more details), 2.53 Å

PDB Description: plasmodium vivax reticulocyte binding protein 2b (pvrbp2b) bound to monoclonal antibody 3e9
PDB Compounds: (C:) Monoclonal antibody 3E9 Fab light chain

SCOPe Domain Sequences for d6bpac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bpac2 b.1.1.0 (C:130-234) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d6bpac2:

Click to download the PDB-style file with coordinates for d6bpac2.
(The format of our PDB-style files is described here.)

Timeline for d6bpac2:

  • d6bpac2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6bpac1