PDB entry 5vnt

View 5vnt on RCSB PDB site
Description: Solution NMR Structure of the C-terminal Headpiece Domain of Villin 4 from A.thaliana, the First Non-Vertebrate Headpiece Structure
Class: protein binding
Keywords: villin, headpiece, PROTEIN BINDING
Deposited on 2017-05-01, released 2017-05-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Villin-4
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: VLN4, At4g30160, F6G3.190, F9N11.10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5vnta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5vntA (A:)
lpahpydrlkttstdpvsdidvtrreaylsseefkekfgmtkeafyklpkwkqnkfkmav
qlf