SCOPe 2.06: Domain d5vnta_: 5vnt A:

Lineage for d5vnta_ (5vnt A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
   3 short helices; irregular array

4. Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families)

5. Family a.14.1.0: automated matches [254251] (1 protein)
   not a true family

6. Protein automated matches [254571] (2 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [334337] (1 PDB entry)

8. Domain d5vnta_: 5vnt A: [334338]
   automated match to d2rjva_

Details for d5vnta_

PDB Entry: 5vnt

PDB Description: solution nmr structure of the c-terminal headpiece domain of villin 4 from a.thaliana, the first non-vertebrate headpiece structure

PDB Compounds: (A:) Villin-4

SCOPe Domain Sequences for d5vnta_:

Sequence; same for both SEQRES and ATOM records:

>d5vnta_ a.14.1.0 (A:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
lpahpydrlkttstdpvsdidvtrreaylsseefkekfgmtkeafyklpkwkqnkfkmav
qlf

Timeline for d5vnta_:

• d5vnta_ is new in SCOPe 2.06-stable
  
• d5vnta_ appears in SCOPe 2.07
  
• d5vnta_ appears in the current release, SCOPe 2.08