PDB entry 5thp

View 5thp on RCSB PDB site
Description: Rhodocetin in complex with the integrin alpha2-A domain
Class: cell adhesion
Keywords: C-type lectin, integrin, venom, coagulation, CELL ADHESION
Deposited on 2016-09-30, released 2017-08-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpa_
  • Chain 'B':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpb_
  • Chain 'C':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpc_
  • Chain 'D':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpd_
  • Chain 'E':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpe_
  • Chain 'F':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpf_
  • Chain 'G':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpg_
  • Chain 'H':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thph_
  • Chain 'I':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpi_
  • Chain 'J':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpj_
  • Chain 'K':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpk_
  • Chain 'L':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpl_
  • Chain 'M':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpm_
  • Chain 'N':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpn_
  • Chain 'O':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpo_
  • Chain 'P':
    Compound: Snaclec rhodocetin subunit gamma
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpp_
  • Chain 'Q':
    Compound: Snaclec rhodocetin subunit delta
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpq_
  • Chain 'R':
    Compound: Integrin alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2, CD49B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5thpr_
  • Heterogens: NA, CL, GOL, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5thpA (A:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpA (A:)
    fnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnni
    krpelyvwiglrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcqak
    npfvckfps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5thpB (B:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpB (B:)
    cplhwyngycyrvfselktwedaesfcyaqhkgsrlasihreeeafvgklasqtlkytsm
    wlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvckf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5thpC (C:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpC (C:)
    lidvvvvcdesnsiwdavknflekfvqgldigptktqvgliqyannprvvfnlntyktke
    emivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsmlk
    avidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaallek
    agtlgeqifs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5thpD (D:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpD (D:)
    fnclpgwsaydqhcyqafnepktwdeaerfcteqaghlvsigsdgeadfvaqlvtnnikr
    pelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcqa
    knpfvckfps
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5thpE (E:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpE (E:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5thpF (F:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpF (F:)
    lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
    ekagtlgeqifsi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5thpG (G:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpG (G:)
    fnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnni
    krpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdc
    qaknpfvckfps
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5thpH (H:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpH (H:)
    cplhwyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlkyts
    mwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvckf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5thpI (I:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpI (I:)
    idvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntyktk
    eemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsml
    kavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaalle
    kagtlgeqifs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5thpJ (J:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpJ (J:)
    nclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnnik
    rpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdcq
    aknpfvckfps
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5thpK (K:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpK (K:)
    vfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlkytsmwlglnnpwkec
    kwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvckf
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5thpL (L:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpL (L:)
    dvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntyktke
    emivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsmlk
    avidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaallek
    agtlgeqif
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5thpM (M:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpM (M:)
    fnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnni
    krpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdc
    qaknpfvckfps
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5thpN (N:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpN (N:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kf
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5thpO (O:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpO (O:)
    slidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqynnprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
    ekagtlgeqif
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5thpP (P:)
    dfnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnn
    ikrpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysd
    cqaknpfvckfpsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpP (P:)
    fnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnni
    krpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdc
    qaknpfvckfps
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5thpQ (Q:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpQ (Q:)
    cplhwssyngycyrvfselktwedaesfcyaqhkgsrlasihsreeeafvgklasqtlky
    tsmwlglnnpwkeckwewsddakldykvwlrrpycavmvvktdrifwfnrgcektvsfvc
    kf
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5thpR (R:)
    mgsshhhhhhssglvprggspslidvvvvcdesnsiypwdavknflekfvqgldigptkt
    qvgliqyannprvvfnlntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasg
    grrsatkvmvvvtdgeshdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikei
    kaiasipteryffnvsdeaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5thpR (R:)
    slivvvvcdesnsiypwdavknflekfvqgldptktqvgliqyannprvvfnlntyktke
    emivatsqtsqygltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsmlkav
    idqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaallekag
    tlgeqif