Lineage for d5thpl_ (5thp L:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144673Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2144674Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2144675Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 2144819Protein automated matches [190060] (1 species)
    not a true protein
  7. 2144820Species Human (Homo sapiens) [TaxId:9606] [186779] (13 PDB entries)
  8. 2144853Domain d5thpl_: 5thp L: [337235]
    Other proteins in same PDB: d5thpa_, d5thpb_, d5thpd_, d5thpe_, d5thpg_, d5thph_, d5thpj_, d5thpk_, d5thpm_, d5thpn_, d5thpp_, d5thpq_
    automated match to d1aoxb_
    complexed with cl, gol, mg, na, so4

Details for d5thpl_

PDB Entry: 5thp (more details), 3.01 Å

PDB Description: rhodocetin in complex with the integrin alpha2-a domain
PDB Compounds: (L:) Integrin alpha-2

SCOPe Domain Sequences for d5thpl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5thpl_ c.62.1.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntyktke
emivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsmlk
avidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaallek
agtlgeqif

SCOPe Domain Coordinates for d5thpl_:

Click to download the PDB-style file with coordinates for d5thpl_.
(The format of our PDB-style files is described here.)

Timeline for d5thpl_: