PDB entry 5jyl

View 5jyl on RCSB PDB site
Description: Human P-cadherin MEC1 with scFv TSP7 bound
Class: cell adhesion/immune system
Keywords: Cadherin Cell adhesion Antibody Protein-protein interaction, OXIDOREDUCTASE, CELL ADHESION-IMMUNE SYSTEM complex
Deposited on 2016-05-14, released 2016-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cadherin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: CDH3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jyla_
  • Chain 'B':
    Compound: scFv TSP7
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JYL (0-End)
    Domains in SCOPe 2.07: d5jylb1, d5jylb2, d5jylb3
  • Chain 'C':
    Compound: Cadherin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: CDH3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jylc_
  • Chain 'D':
    Compound: scFv TSP7
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5JYL (0-End)
    Domains in SCOPe 2.07: d5jyld1, d5jyld2, d5jyld3
  • Heterogens: GOL, PO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jylA (A:)
    mdwvvapisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgw
    lllnkpldreeiakyelfghavsengasvedpmnisiivtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jylA (A:)
    vapisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgwllln
    kpldreeiakyelfghavsengasvedpmnisiivtd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jylB (B:)
    qvqlqesgpelvkpgasvkmsckasgysftaynmhwvkqshgkslewigfidpysgiity
    nqtfkgkatltvdkssstaymqlnsltsedsavyycarrgyydggfdywgqgttltvsss
    aggggsggggsggggsdidiqmtqttsslsaslgdrvtiscrasqditnylnwyqqkpdg
    tvklliyytsrlhsgvpsrfsgsgsgtdysltisnleqediatyfcqqdskhprtfgggt
    kleiksahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jylB (B:)
    qvqlqesgpelvkpgasvkmsckasgysftaynmhwvkqshgkslewigfidpysgiity
    nqtfkgkatltvdkssstaymqlnsltsedsavyycarrgyydggfdywgqgttltvsgg
    gsdidiqmtqttsslsaslgdrvtiscrasqditnylnwyqqkpdgtvklliyytsrlhs
    gvpsrfsgsgsgtdysltisnleqediatyfcqqdskhprtfgggtklei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jylC (C:)
    mdwvvapisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgw
    lllnkpldreeiakyelfghavsengasvedpmnisiivtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jylC (C:)
    apisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgwlllnk
    pldreeiakyelfghavsengasvedpmnisiivtd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5jylD (D:)
    qvqlqesgpelvkpgasvkmsckasgysftaynmhwvkqshgkslewigfidpysgiity
    nqtfkgkatltvdkssstaymqlnsltsedsavyycarrgyydggfdywgqgttltvsss
    aggggsggggsggggsdidiqmtqttsslsaslgdrvtiscrasqditnylnwyqqkpdg
    tvklliyytsrlhsgvpsrfsgsgsgtdysltisnleqediatyfcqqdskhprtfgggt
    kleiksahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jylD (D:)
    qvqlqesgpelvkpgasvkmsckasgysftaynmhwvkqshkslewigfidpysgiityn
    qtfkgkatltvdkssstaymqlnsltsedsavyycarrgyydggfdywgqgttltvsidi
    qmtqttsslsaslgdrvtiscrasqditnylnwyqqkpdgtvklliyytsrlhsgvpsrf
    sgsgsgtdysltisnleqediatyfcqqdskhprtfgggtkl