Lineage for d5jyld2 (5jyl D:138-242)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760864Domain d5jyld2: 5jyl D:138-242 [327783]
    Other proteins in same PDB: d5jyla_, d5jylb3, d5jylc_, d5jyld3
    automated match to d1f3rb2
    complexed with cl, gol, po4

Details for d5jyld2

PDB Entry: 5jyl (more details), 2.55 Å

PDB Description: human p-cadherin mec1 with scfv tsp7 bound
PDB Compounds: (D:) scFv TSP7

SCOPe Domain Sequences for d5jyld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jyld2 b.1.1.0 (D:138-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
idiqmtqttsslsaslgdrvtiscrasqditnylnwyqqkpdgtvklliyytsrlhsgvp
srfsgsgsgtdysltisnleqediatyfcqqdskhprtfgggtkl

SCOPe Domain Coordinates for d5jyld2:

Click to download the PDB-style file with coordinates for d5jyld2.
(The format of our PDB-style files is described here.)

Timeline for d5jyld2: