| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
| Family b.1.6.1: Cadherin [49314] (4 proteins) |
| Protein automated matches [327642] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [327643] (1 PDB entry) |
| Domain d5jyla_: 5jyl A: [327644] Other proteins in same PDB: d5jylb1, d5jylb2, d5jylb3, d5jyld1, d5jyld2, d5jyld3 automated match to d1suha_ complexed with cl, gol, po4 |
PDB Entry: 5jyl (more details), 2.55 Å
SCOPe Domain Sequences for d5jyla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jyla_ b.1.6.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vapisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgwllln
kpldreeiakyelfghavsengasvedpmnisiivtd
Timeline for d5jyla_: