Lineage for d5jyla_ (5jyl A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763415Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2763505Protein automated matches [327642] (1 species)
    not a true protein
  7. 2763506Species Human (Homo sapiens) [TaxId:9606] [327643] (1 PDB entry)
  8. 2763507Domain d5jyla_: 5jyl A: [327644]
    Other proteins in same PDB: d5jylb1, d5jylb2, d5jylb3, d5jyld1, d5jyld2, d5jyld3
    automated match to d1suha_
    complexed with cl, gol, po4

Details for d5jyla_

PDB Entry: 5jyl (more details), 2.55 Å

PDB Description: human p-cadherin mec1 with scfv tsp7 bound
PDB Compounds: (A:) Cadherin-3

SCOPe Domain Sequences for d5jyla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jyla_ b.1.6.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vapisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgwllln
kpldreeiakyelfghavsengasvedpmnisiivtd

SCOPe Domain Coordinates for d5jyla_:

Click to download the PDB-style file with coordinates for d5jyla_.
(The format of our PDB-style files is described here.)

Timeline for d5jyla_: