PDB entry 5jh5

View 5jh5 on RCSB PDB site
Description: Structural Basis for the Hierarchical Assembly of the Core of PRC1.1
Class: metal binding protein/transcription
Keywords: gene repression, complex, transcription regulation, transcription repressor, METAL BINDING PROTEIN-TRANSCRIPTION complex
Deposited on 2016-04-20, released 2016-09-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific demethylase 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM2B, CXXC2, FBL10, FBXL10, JHDM1B, PCCX2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: S-phase kinase-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SKP1, EMC19, OCP2, SKP1A, TCEB1L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jh5b1, d5jh5b2
  • Chain 'C':
    Compound: Polycomb group RING finger protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PCGF1, NSPC1, RNF68
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: BCL-6 corepressor-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BCORL1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jh5B (B:)
    psiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviqw
    cthhkddppppeddenkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtck
    tvanmikgktpeeirktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jh5B (B:)
    psiklqssdgeifevdveiakqsvtiktmledlgmpvplpnvnaailkkviqwcthhkdd
    ppppednkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgk
    tpeeirktfnikndfteeeeaqvrkenqw
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.