SCOPe 2.06: Domain d5jh5b2: 5jh5 B:77-159

Lineage for d5jh5b2 (5jh5 B:77-159)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)

6. Protein automated matches [226933] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225235] (6 PDB entries)

8. Domain d5jh5b2: 5jh5 B:77-159 [322625]
   Other proteins in same PDB: d5jh5b1
   automated match to d3wsob2

Details for d5jh5b2

PDB Entry: 5jh5, 2.55 Å

PDB Description: structural basis for the hierarchical assembly of the core of prc1.1

PDB Compounds: (B:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d5jh5b2:

Sequence; same for both SEQRES and ATOM records:

>d5jh5b2 a.157.1.1 (B:77-159) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeir
ktfnikndfteeeeaqvrkenqw

Timeline for d5jh5b2:

• d5jh5b2 is new in SCOPe 2.06-stable
  
• d5jh5b2 appears in SCOPe 2.07
  
• d5jh5b2 appears in the current release, SCOPe 2.08