PDB entry 4tx4

View 4tx4 on RCSB PDB site
Description: Crystal Structure of a Single-Domain Cysteine Protease Inhibitor from Cowpea (Vigna unguiculata)
Class: hydrolase inhibitor
Keywords: Cysteine Protease Inhibitor, HYDROLASE INHIBITOR
Deposited on 2014-07-02, released 2015-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine proteinase inhibitor
    Species: Vigna unguiculata [TaxId:3917]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tx4a_
  • Chain 'B':
    Compound: Cysteine proteinase inhibitor
    Species: Vigna unguiculata [TaxId:3917]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tx4b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tx4A (A:)
    nsleidslarfaveehnkkqnallefgrvvsaqqqvvsgtlytitleakdggqkkvyeak
    vwekpwlnfkelqefkhvgdapa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tx4B (B:)
    nsleidslarfaveehnkkqnallefgrvvsaqqqvvsgtlytitleakdggqkkvyeak
    vwekpwlnfkelqefkhvgdapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tx4B (B:)
    sleidslarfaveehnkkqnallefgrvvsaqqqvvsgtlytitleakdggqkkvyeakv
    wekpwlnfkelqefkhvgd